Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloeobacter violaceus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Gloeobacter violaceus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-474.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

Q7NJ11

Expression Region

1-474

Origin

Gloeobacter violaceus (strain PCC 7421)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSDGLQWVSRSLEHRPMTSLWRDIRHEVAAWLGSLKLAIGLFLAIAAASIAGTVIPQGE STDFYRQNYPDSGAVVWGFVTWRFIISLGLDEVYRSWWFVALLLLLATSLTICTFRRQIP MLKAAQNWKFYTEPRQLSKYALRTAIPARGTGPLAEQLRAGRYKVYQRDDLIYATKGTIG RVGPIVVHVSLLLIMAGAMIGAFGGYQTQRMTLAGDSFDIQQVEQSRLSLARPPDWTVRV NKFWIDYRPDGSVDQFHSDLSVVSPAGKELERKTISVNDPLIYDGVTMYQASWAVGAFKL RLNDSPVLTIPMQPIEAPNGQEAWGQAIPFDKDGRVALQMVTRGLQGSLMLLPFNPRTGE TVREAATPARVGKPVSVLGQRLVIEELVGQTGIQIKADPGIPVVYAGFALLMVGLAMSYL SHSQVWAIYRDGQLHVAGRTNRAQIGFERELVRMVAAVQTPRPRTSDALSAAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-100 1x 100 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details