Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens Cardiolipin synthase (cls)

This Recombinant Clostridium perfringens Cardiolipin synthase (cls) spans the amino acid sequence from region 1-476.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q0ST20

Expression Region

1-476

Origin

Clostridium perfringens (strain SM101 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLLINIIFLINIIFIISIIFIERRNPQTTWAWILILTFLPILGFIIYILFGQNITREKN FKRKILDDKTKQKYLNSFKSHYKLDNISLKYKDLIMMNFNNDNSTYTQRNDIDLYFDANS LFQEMIYEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGNSIHKK DIDKLKAAGGDFKIFFPGFCKYINLRINYRNHRKILIIDSKVAFLGGFNIGDEYLGKDKN IGNWRDTHTKIKGLAINDLEARFLLDWSYANESDLDIDLKKYFINPHSTNLPNNIIGAQI VSSGPDHTEQQIKNGYFKIINSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPG NPDHKFMEWIANSYFESLLNAGVKIYLYEKGFLHAKTIVADSSICSVGTANMDIRSFSLN FESNIFIYNEAISKSMEEQFFKDLKVCTKVTLESFEKRSIISRIGESIIRLVSPLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details