Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sterol regulatory element-binding protein 2 (Srebf2)

This Recombinant Rat Sterol regulatory element-binding protein 2 (Srebf2) spans the amino acid sequence from region 1-476.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q3T1I5

Expression Region

1-476

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDENSELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFSDLFSEQLCSSFPGGGGG SGSGGTSNNSSGRGTSGGAADPAVQRSFSQVPLSTFSPSSTSPQAPALQVKVSPTPPRAT PVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSL VTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVATPQVQQVPVLVQPQII KTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGAILTTMPVMMGQ EKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSG VLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNV LLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPO Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV663003 1.0 µg DNA

TPO Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GNAT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
22306064 1.0 µg DNA

GNAT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Mouse Lgr6 Fc Chimera CF
8029-GP-050 50 µg

Recombinant Mouse Lgr6 Fc Chimera CF

Sign In for Pricing
View Details
Human OR10A2 Pre-designed siRNA Set A
SI011087A 1 Each

Human OR10A2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Methyl 2-amino-2-cyclopropylacetate hydrochloride
KWA93686 2.5 g

Methyl 2-amino-2-cyclopropylacetate hydrochloride

Sign In for Pricing
View Details
Netrin-1 Antibody
OAAF05864-100UG 100 µg

Netrin-1 Antibody

Sign In for Pricing
View Details