Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sterol regulatory element-binding protein 2 (Srebf2)

This Recombinant Rat Sterol regulatory element-binding protein 2 (Srebf2) spans the amino acid sequence from region 1-476.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q3T1I5

Expression Region

1-476

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDENSELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFSDLFSEQLCSSFPGGGGG SGSGGTSNNSSGRGTSGGAADPAVQRSFSQVPLSTFSPSSTSPQAPALQVKVSPTPPRAT PVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSL VTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVATPQVQQVPVLVQPQII KTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGAILTTMPVMMGQ EKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSG VLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNV LLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP1 293 Cell Lysate
407260 0.1 mg

VAMP1 293 Cell Lysate

Sign In for Pricing
View Details
AChE-IN-39
MBS5820478 Inquire

AChE-IN-39

Sign In for Pricing
View Details
Monkey anti-PF4 ELISA Kit
EMKH0254 96 Tests

Monkey anti-PF4 ELISA Kit

Sign In for Pricing
View Details
CMTM7 CRISPR Knock Out 293T Cell Line (Human)
16438141 1x 10^6 Cells / 1.0 mL

CMTM7 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Smad4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-23966R-BF647 100 µL

Smad4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
EVI1, NT (MECOM, EVI1, MDS1 and EVI1 complex locus protein EVI1, Ecotropic virus integration site 1 protein homolog) (APC)
MBS6296999-01 0.2 mL

EVI1, NT (MECOM, EVI1, MDS1 and EVI1 complex locus protein EVI1, Ecotropic virus integration site 1 protein homolog) (APC)

Sign In for Pricing
View Details