Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cardiolipin synthase (cls)

This Recombinant Cardiolipin synthase (cls) spans the amino acid sequence from region 1-476.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

P0C2E2

Expression Region

1-476

Origin

Clostridium perfringens

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLFINMIFLINIVFIISIIFIERRNPQTTWAWILILTFLPILGFIIYILFGQNITREKN FKRKILDDKTKQKYLNSFKSHYKLDNISLKYKDLIMMNFNNDNSTYTQRNDIDLYFDANS LFEEMIDEINKAEKFIHMEFYIFKSDEIGKKILQALTKKAKEGVEVKLLVDSIGNSIHKK DIDKLKAAGGDFKIFFPGFCKYINLRINYRNHRKILIIDSKVAFLGGFNIGDEYLGKDKN IGHWRDTHTKIKGLAINDLEGRFLLDWSYANESDLDIDLKKYFINPHSTDLPKKIIGAQI VSSGPDHTEQQIKNGYFKIINSAKKNLFIQTPYFVPDEPMLEALRLAALSGVDVKIMLPG NPDHKFMGWIANSYFESLLNAGAKIYLYEKGFLHAKTIVADSSICSVGTANMDIRSFSLN FESNIFIYNEAISKSMEEQFFKDLKVCTKVTLESFEKRSIISRIGESITRLVSPLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptgds (BC038083) Mouse Tagged ORF Clone
MG200672 10 µg

Ptgds (BC038083) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL
BNC881600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF488A conjugate, 0.1mg/mL
BNC882418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHST10 Rabbit Polyclonal Antibody
TA369977 100 µL

CHST10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human sCD163 Protein (His Tag)
PDMH100228-01 20 µg

Recombinant Human sCD163 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human sCD163 Protein (His Tag)
PDMH100228-02 100 µg

Recombinant Human sCD163 Protein (His Tag)

Sign In for Pricing
View Details