Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hantaan virus Envelope glycoprotein (GP)

This Recombinant Hantaan virus Envelope glycoprotein (GP) spans the amino acid sequence from region 649-1126.

Product Specifications

Product Name Alternative

Envelope glycoprotein, GP, M polyprotein, Cleaved into the following 2 chains:, 1. Glycoprotein G1, 2. Glycoprotein G2

UniProt

P08668

Expression Region

649-1126

Origin

Hantaan virus (strain 76-118) (Korean hemorrhagic fever virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIE EQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPS DCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRH VKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEF PGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGML RDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIK ACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNG ISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSLVLLSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-LO Polyclonal Antibody
UB-GEN-2388 100 µL

5-LO Polyclonal Antibody

Sign In for Pricing
View Details
CYP4F3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0553708 1.0 µg DNA

CYP4F3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HIST1H1C ORF Vector (Human) (pORF)
23306011 1.0 µg DNA

HIST1H1C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Influenza A virus Non-structural protein 1
565704-01 50 µg

Influenza A virus Non-structural protein 1

Sign In for Pricing
View Details
Influenza A virus Non-structural protein 1
565704-02 100 µg

Influenza A virus Non-structural protein 1

Sign In for Pricing
View Details
pCMV-ADAMTS1-3×FLAG-Neo Plasmid
PVT54699 2 µg

pCMV-ADAMTS1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details