Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Cardiolipin synthase (cls)

This Recombinant Pseudomonas fluorescens Cardiolipin synthase (cls) spans the amino acid sequence from region 1-479.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q4K3D9

Expression Region

1-479

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYFGPHIFGYLIALLHFLGLIAAIHAVLTVRTAQGAIAWALSLLFMPYLTLIPYLVFGR STFDAYIQARRQANVEMHKAINELNWRPWVEEALTARASKAYASLRAMPKLGRMPCLANN QVRLLVNGDATFEAIFNAIRRSHKAVLIQFFIIHDDDLGRRLQRLLLEKAAEGVSIHLLY DRIGSHSLPASYVQTLRDAGVQVHAFATRSGWLNRFQVNFRNHRKIVVVDGMLGFVGGHN VGDEYLGKKPPLAPWRDTHVQVSGPVVACLQESFAEDWFWAARELPPLILPDTYPDDGVL CQLLASGPADAYETCSLFFVEAIHAATERVWITSPYFIPDEAVFAALRLAVLRDVDVRIL LPARPDHRIVYAASSLYAFEAVRAGVRVFRYQPGFLHQKVVLIDNEISAIGSANLDNRSF RLNFEVMLLTVDDDFATEVEHMLEADFAKAREIAKEESRQTHRLQQLGMRVARLISPIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF740 conjugate, 0.1mg/mL
BNC742978-500 1x 500 µL

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL
BNC941282-500 1x 500 µL

ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI8E10]
CF812657 100 µg

ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI8E10]

Sign In for Pricing
View Details
Human GTSE1 activation kit by CRISPRa
GA109844 1 Kit

Human GTSE1 activation kit by CRISPRa

Sign In for Pricing
View Details
NFH (NEFH) Mouse Monoclonal Antibody [Clone ID: SPM563]
AM50147PU-T 20 µg

NFH (NEFH) Mouse Monoclonal Antibody [Clone ID: SPM563]

Sign In for Pricing
View Details
Efcab11 (NM_030172) Mouse Tagged ORF Clone
MG201275 10 µg

Efcab11 (NM_030172) Mouse Tagged ORF Clone

Sign In for Pricing
View Details