Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato Cardiolipin synthase (cls)

This Recombinant Pseudomonas syringae pv. tomato Cardiolipin synthase (cls) spans the amino acid sequence from region 1-479.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q87TY7

Expression Region

1-479

Origin

Pseudomonas syringae pv. tomato (strain DC3000)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYHDPYFFGYVLGFIHLLGTGAAIHALLTVRTSQGAIAWAMPLLFIPYFTLLPYLIFGR SSFDAYIKARREANKEMRAAIGSLNWRPWIEEAVAARRSDAYAALRAMPRLGNMPALANN KVRLLINGEETFGAIFQAIREAKQTILIQFFIIHDDNLGRQLQTLLLEKAAQGVAIFVLY DRIGSHALPGAYIDTLRDGGVQIKAFATRGGWLNRFQINFRNHRKIVVVDGLKGYIGGHN VGDEYMGLKPPLAPWRDTHVEVIGPVVACLQESFAEDWFWATRELPPLSLPDEFPEDGVL CQLLTSGPADAQETCSLFFVEAIHAAEERVWITSPYFIPDEAVSAALTLAVLRGVDVRLL LPSRPDHYVVYAASSLYAFDAVRAGVRVFRYEPGFLHQKVVLVDNDITAIGSANLDNRSF RLNFELMLLTVDSDFSSQVEAMLTADFAAAREISLQESHETRRLHQLGMRVARLISPIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF488A conjugate, 0.1mg/mL
BNC882085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details