Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Cardiolipin synthase (cls)

This Recombinant Pseudomonas putida Cardiolipin synthase (cls) spans the amino acid sequence from region 1-479.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

A5WB80

Expression Region

1-479

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYHSPYFFGYLLGMIHLLGIVAALHALFTVRTAQGAIAWAMPLLFIPYLTLIPYLIFGA RSFYAYIKARRQANQEMHVAMANLNWRPWVEEALTARESESYAALRAMPKLGRMPCLANN QVKLLINGKATFDAIFAAIEKARDVVLVQFFIIHDDTLGKALQQLLLRKAAEGVQVFVLY DRVGSHALPASYSQMLRDGGVQIHAFATRRGWFNRFQVNFRNHRKIVVVDGLLGFIGGHN VGDEYLGEHPQLSPWRDTHVQISGPVLACLQESFAEDWYWATRQLPPLILPDTYPDNGVL CQALASGPADPQETCSLFFLEAIHSATRRVWITSPYFIPDEAVFAALRLAVLRGVDVRVL IPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQPGFLHQKVVLVDDDVSAIGSANLDNRSF RLNFEITLLTVDRGFADQVEHMLHEDFEHAREITAEDTQDTHRLQQLGMRIARLISPIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (HP6053 + L1C1), CF640R conjugate, 0.1mg/mL
BNC400755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HES6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]
TA800717AM 100 µL

HES6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details
Ilk (N-term) Rabbit Polyclonal Antibody
AP14363PU-N 400 µL

Ilk (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Bromo-4,6-difluorobenzoic Acid
TRC-B683970-5G 5 g

3-Bromo-4,6-difluorobenzoic Acid

Sign In for Pricing
View Details
Porcine Epidermal Growth Factor (EGF) ELISA Kit
RD-EGF-p-01 96 Tests

Porcine Epidermal Growth Factor (EGF) ELISA Kit

Sign In for Pricing
View Details
Porcine Epidermal Growth Factor (EGF) ELISA Kit
RD-EGF-p-02 48 Tests

Porcine Epidermal Growth Factor (EGF) ELISA Kit

Sign In for Pricing
View Details