Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 46-525.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q4I099

Expression Region

46-525

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SKRSSGQPPKESKKKPSQAQNDAEAAKTPEKPAENDVNKASEQSPEAPKEGEQIPFHKLP DLTQGIPSTLFEEMGGDKKKEQQALQELEEAESKGNERDRSEYVSTSERNRKWWTRFMLT AVAAGGTLSLLYMGRNWEDTIEAERHSDSPNGPSPSLWWKRAKARMTESVTYYQEPAFEK LLPDPDPTFERPYTLCLSLDDLLIHSEWTREHGWRIAKRPGVDYFIRYLSQYYELVLFTT TPYATGEPVMRKLDPFRLILWPLYREATKFEDGEIVKDLSYLNRDLSKVIIIDTKAKHVR NQPDNAIILDPWKGDKDDKNLVNLIPFLEYIHTMQYSDVRKVIKSFDGKDIPTEFARREA IARKEFQAKQLTHKHKHGSGVGALGNMLGLKPSNMNMMVSPDGEQNPAEAFAQGKMLQDV ARERGQRNYMELEKQIRENGEKWLKEEAAMMEAAQKEAMNSMMGSFGGWFGGNNPPEKKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hbz sgRNA CRISPR Lentivector set (Rat)
K6570501 3x 1.0 µg

Hbz sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant human Smad3 protein
ATGP0421-100 100 µg

Recombinant human Smad3 protein

Sign In for Pricing
View Details
Lentiviral mouse Kif1bp shRNA (UAS) - Lentiviral mouse Kif1bp shRNA (UAS) (100)
GTR15221706 1 Vial

Lentiviral mouse Kif1bp shRNA (UAS) - Lentiviral mouse Kif1bp shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral human RAB4B sgRNA gene knockout kit - Lentiviral human RAB4B sgRNA gene knockout kit (100)
GTR15356917 1 Vial

Lentiviral human RAB4B sgRNA gene knockout kit - Lentiviral human RAB4B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human SMAD3 sgRNA gene knockout kit - Lentiviral human SMAD3 sgRNA gene knockout kit (25)
GTR15378186 1 Vial

Lentiviral human SMAD3 sgRNA gene knockout kit - Lentiviral human SMAD3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral mouse Slc25a17 shRNA (UAS) - Lentiviral mouse Slc25a17 shRNA (UAS, GFP) (100)
GTR15272049 1 Vial

Lentiviral mouse Slc25a17 shRNA (UAS) - Lentiviral mouse Slc25a17 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details