Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sterol regulatory element-binding protein 1 (Srebf1)

This Recombinant Rat Sterol regulatory element-binding protein 1 (Srebf1) spans the amino acid sequence from region 1-480.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 1, SREBP-1, Adipocyte determination- and differentiation-dependent factor 1, ADD1, Sterol regulatory element-binding transcripti

UniProt

P56720

Expression Region

1-480

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDELPFGEAALEQALAEVCEMDAALLTDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG PSSPGASSPESFSSPASLGSSLEAFLGGPKVTPAPLSPPPSAPTAVKMYPSVPPFSPGPG IKEEPVPLTILQPPAPQPSPGTLLPPSFPPPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQ TPSSLPLGSTPGISPTPLHTQVQSSAAQQPPPASAAPRMSTVASQIQQVPVVLQPHFIKA DSLLLTAVKTDTGATMKTAGINTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGGKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP PPSDAGSPSQSSPLSLGSRGSSSGGSDSEPDSPAFEDNQVKAQRLPSHSRGMLDRSRLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)
MBS7032827-01 0.02 mg

Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)
MBS7032827-02 0.1 mg

Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)
MBS7032827-03 5x 0.1 mg

Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B23 (UGT2B23)

Sign In for Pricing
View Details
EXD Blocking Peptide
33R-2263 100 ug

EXD Blocking Peptide

Sign In for Pricing
View Details
Human Fatty acid-binding protein 9 (FABP9) Elisa Kit
EK712350 96 Well

Human Fatty acid-binding protein 9 (FABP9) Elisa Kit

Sign In for Pricing
View Details
Zic5 Mouse shRNA Plasmid (Locus ID 65100)
TR509786 1 Kit

Zic5 Mouse shRNA Plasmid (Locus ID 65100)

Sign In for Pricing
View Details