Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Ftsk domain-containing protein YdcQ (ydcQ)

This Recombinant Bacillus subtilis Ftsk domain-containing protein YdcQ (ydcQ) spans the amino acid sequence from region 1-480.

Product Specifications

Product Name Alternative

Ftsk domain-containing protein YdcQ

UniProt

P96634

Expression Region

1-480

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFLNKRFWKYRGKRIRPYMRNNVKLAGAIIFVPVFLLSMFLFWREQLIHFDLSQVIKN FEWNVPLIIKSVLCSVLIAVGSIVASYFLLFDSYKKILHRQKIAKMIFSNKFYEKENVKV RKIFSNETDSKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLV DKQMEEGFVCFKLLYDVKKNRISIDDAVAENGVLPLMKHISWQFDKLPHMLIAGGTGGGK TYFMLTIIKACVGLGADVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMER MDEMKQMSNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQA GYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVEKAYVNKKETGRGYA NVGTGSVLEFYSPIVPKGYDFMSSIKNALVGVEGAQATAVASGSVSDQTASGEGVSEANG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNU1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
25434151 3x 1.0 µg DNA

KCNU1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
p95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone ID: OTI5E11]
TA801424S 30 µL

p95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone ID: OTI5E11]

Sign In for Pricing
View Details
Retrotransposon-derived protein PEG10
AP86445-01 50 µg

Retrotransposon-derived protein PEG10

Sign In for Pricing
View Details
Retrotransposon-derived protein PEG10
AP86445-02 100 µg

Retrotransposon-derived protein PEG10

Sign In for Pricing
View Details
Retrotransposon-derived protein PEG10
AP86445-03 1 mg

Retrotransposon-derived protein PEG10

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)
MBS2092896-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase (MYLK)

Sign In for Pricing
View Details