Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Ftsk domain-containing protein YdcQ (ydcQ)

This Recombinant Bacillus subtilis Ftsk domain-containing protein YdcQ (ydcQ) spans the amino acid sequence from region 1-480.

Product Specifications

Product Name Alternative

Ftsk domain-containing protein YdcQ

UniProt

P96634

Expression Region

1-480

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFLNKRFWKYRGKRIRPYMRNNVKLAGAIIFVPVFLLSMFLFWREQLIHFDLSQVIKN FEWNVPLIIKSVLCSVLIAVGSIVASYFLLFDSYKKILHRQKIAKMIFSNKFYEKENVKV RKIFSNETDSKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLV DKQMEEGFVCFKLLYDVKKNRISIDDAVAENGVLPLMKHISWQFDKLPHMLIAGGTGGGK TYFMLTIIKACVGLGADVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMER MDEMKQMSNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQA GYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVEKAYVNKKETGRGYA NVGTGSVLEFYSPIVPKGYDFMSSIKNALVGVEGAQATAVASGSVSDQTASGEGVSEANG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5ml Pipet Tips
27-345 10 Racks of 50 Tips/Unit

5ml Pipet Tips

Sign In for Pricing
View Details
Pollen Allergen Phl P 5A Antibody
abx422472-01 100 µg

Pollen Allergen Phl P 5A Antibody

Sign In for Pricing
View Details
Pollen Allergen Phl P 5A Antibody
abx422472-02 1 mg

Pollen Allergen Phl P 5A Antibody

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA Monoclonal Antibody
ANT-11019-100ug 100 µg

CD269 / TNFRSF17 / BCMA Monoclonal Antibody

Sign In for Pricing
View Details
MGC21874 (Transcriptional Adaptor 2 (ADA2 Homolog, yeast) -beta, ADA2 (beta), ADA2B, MGC21874) (MaxLight 550)
248718-ML550 100 µL

MGC21874 (Transcriptional Adaptor 2 (ADA2 Homolog, yeast) -beta, ADA2 (beta), ADA2B, MGC21874) (MaxLight 550)

Sign In for Pricing
View Details
Anti-PSA Monoclonal Antibody (Clone:IHC654)
44-1074-0.1 0.1 mL

Anti-PSA Monoclonal Antibody (Clone:IHC654)

Sign In for Pricing
View Details