Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein

This Recombinant Rubella virus Structural polyprotein spans the amino acid sequence from region 583-1063.

Product Specifications

Product Name Alternative

Structural polyprotein, p110, Cleaved into the following 3 chains:, 1. Capsid protein, Coat protein, C, E2 envelope glycoprotein, Spike gl

UniProt

P08564

Expression Region

583-1063

Origin

Rubella virus (strain TO-336) (RUBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGASCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEX3A Rabbit Polyclonal Antibody
orb587187 100 µL

MEX3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8423284-01 0.12 mL

Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8423284-02 0.2 mL

Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8423284-03 5x 0.2 mL

Rabbit Anti CERS5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Urocortin (UCN)
MBS2116810-01 1 mL

APC-Cy7 Linked Polyclonal Antibody to Urocortin (UCN)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Urocortin (UCN)
MBS2116810-02 5 mL

APC-Cy7 Linked Polyclonal Antibody to Urocortin (UCN)

Sign In for Pricing
View Details