Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein

This Recombinant Rubella virus Structural polyprotein spans the amino acid sequence from region 583-1063.

Product Specifications

Product Name Alternative

Structural polyprotein, p110, Cleaved into the following 3 chains:, 1. Capsid protein, Coat protein, C, E2 envelope glycoprotein, Spike gl

UniProt

Q6X2U1

Expression Region

583-1063

Origin

Rubella virus (strain BRDII) (RUBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPAAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACDVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPDKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYHLRGAIAP R

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human T4 ELISA Kit
orb1085818 96 Tests

Human T4 ELISA Kit

Sign In for Pricing
View Details
STH sgRNA CRISPR Lentivector (Human) (Target 3)
K2302004 1.0 µg DNA

STH sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal DUSP23 Antibody (OTI3C10) [Alexa Fluor 647]
NBP2-71976AF647 0.1 mL

Mouse Monoclonal DUSP23 Antibody (OTI3C10) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Integrin alpha 4/CD49d MAb (Clone 599904)
MAB13541-SP 25 µg

Human Integrin alpha 4/CD49d MAb (Clone 599904)

Sign In for Pricing
View Details
Recombinant Mycoplasma gallisepticum DNA topoisomerase 4 subunit B (parE), partial
MBS1340031 Inquire

Recombinant Mycoplasma gallisepticum DNA topoisomerase 4 subunit B (parE), partial

Sign In for Pricing
View Details
Scarb2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7107004 1.0 µg DNA

Scarb2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details