Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Probable squalene synthase (erg-9)

This Recombinant Neurospora crassa Probable squalene synthase (erg-9) spans the amino acid sequence from region 1-481.

Product Specifications

Product Name Alternative

Probable squalene synthase, SQS, SS, EC= 2.5.1.21, FPP:FPP farnesyltransferase, Farnesyl-diphosphate farnesyltransferase

UniProt

Q7S4Z6

Expression Region

1-481

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Cancer Biology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAFTKAAYFLLHPNQLRSIVQWKVWHEPVHRRDPSKETETEKACFRHLELTSRSFSAVI QELNPELLMPICLFYLVLRGLDTIEDDMTIDLAKKEPLLREFADLMEIDGWTFTENGPNE KDRELLVHFDDVIAELKKVKKPYYDIIREITVKMGNGMADYALNAEHNTNGVNTIEEYEL YCHYVAGLVGEGLTRLFVESNLANPALLERMELTESMGQFLQKTNIIRDIHEDYVDKRRF WPKTIWSKYVNTWDDMFKPENREKALQCSSEMVLNALKHTEDCLFYMAGMRDQSVFNFVA IPQAMAIATLELVFRNPAIFERNVKITKGDACQLMMESTQNLRVVCEVFRRYARRIHKKN DPRDPNYLAISVQCGKIEQFIESIFPTQDPKKIALAQAQNSNQTAANTTDNGDTTFLVLS MIGVLFVMGGLMIGAAWLMGARFDMAYEDITARVGTLVNGAAAVSSATVSSIPTTVMHQE L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATHfinder - 2x2-Plex Real-Time PCR kit for the detection of foodborne STEC stx1/stx2 & eae/IAC (based on ISO13136)
PMB10A-50 50 + 50 Tests

PATHfinder - 2x2-Plex Real-Time PCR kit for the detection of foodborne STEC stx1/stx2 & eae/IAC (based on ISO13136)

Sign In for Pricing
View Details
DLG7, ID (DLGAP5, DLG7, KIAA0008, Disks large-associated protein 5, Discs large homolog 7, Disks large-associated protein DLG7, Hepatoma up-regulated protein) (MaxLight 490) discontinued
034662-ML490 100 µL

DLG7, ID (DLGAP5, DLG7, KIAA0008, Disks large-associated protein 5, Discs large homolog 7, Disks large-associated protein DLG7, Hepatoma up-regulated protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MRP5 Polyclonal Antibody, PE-Cy7 Conjugated
bs-1437R-PE-Cy7 100 µL

MRP5 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ZNF518A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2711606 1.0 µg DNA

ZNF518A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ZNF703 Antibody, HRP conjugated
A39156-50UG 50 µg

ZNF703 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral mouse Itk shRNA (UAS) - Lentiviral mouse Itk shRNA (UAS, GFP) (100)
GTR15250689 1 Vial

Lentiviral mouse Itk shRNA (UAS) - Lentiviral mouse Itk shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details