Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein

This Recombinant Rubella virus Structural polyprotein spans the amino acid sequence from region 583-1063.

Product Specifications

Product Name Alternative

Structural polyprotein, p110, Cleaved into the following 3 chains:, 1. Capsid protein, Coat protein, C, E2 envelope glycoprotein, Spike gl

UniProt

Q99IE6

Expression Region

583-1063

Origin

Rubella virus (strain TO-336 vaccine) (RUBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGASCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIRAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTLNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC37A Human shRNA Lentiviral Particle (Locus ID 9884)
TL311667V 500 µL Each

LRRC37A Human shRNA Lentiviral Particle (Locus ID 9884)

Sign In for Pricing
View Details
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
MBS2503292-01 24 Tests (Limit 1)

Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit

Sign In for Pricing
View Details
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
MBS2503292-02 48 Tests

Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit

Sign In for Pricing
View Details
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
MBS2503292-03 96 Tests

Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit

Sign In for Pricing
View Details
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
MBS2503292-04 5x 96 Tests

Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit

Sign In for Pricing
View Details
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
MBS2503292-05 10x 96 Tests

Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit

Sign In for Pricing
View Details