Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein

This Recombinant Rubella virus Structural polyprotein spans the amino acid sequence from region 583-1063.

Product Specifications

Product Name Alternative

Structural polyprotein, p110, Cleaved into the following 3 chains:, 1. Capsid protein, Coat protein, C, E2 envelope glycoprotein, Spike gl

UniProt

Q9J6K8

Expression Region

583-1063

Origin

Rubella virus (strain Cendehill) (RUBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCDVTT EHPFCNTPHGQLEVQVPPDPGDMVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVTLPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALPLAGLLACCAKCLYYLRGAIAP R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-mouse CD2
FC0962 100 Tests

FITC anti-mouse CD2

Sign In for Pricing
View Details
Recombinant PEDV S1/Spike glycoprotein 1 Protein, N-His & C-His
E55P6285 50 µg

Recombinant PEDV S1/Spike glycoprotein 1 Protein, N-His & C-His

Sign In for Pricing
View Details
Tmem20 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4872604 1.0 µg DNA

Tmem20 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TFIISH (TCEA3) (NM_003196) Human Recombinant Protein
TP308347M 100 µg

TFIISH (TCEA3) (NM_003196) Human Recombinant Protein

Sign In for Pricing
View Details
RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (FITC)
132556-FITC 100 µL

RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (FITC)

Sign In for Pricing
View Details
SOCS5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2257508 1.0 µg DNA

SOCS5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details