Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein

This Recombinant Rubella virus Structural polyprotein spans the amino acid sequence from region 583-1063.

Product Specifications

Product Name Alternative

Structural polyprotein, p110, Cleaved into the following 3 chains:, 1. Capsid protein, Coat protein, C, E2 envelope glycoprotein, Spike gl

UniProt

P19725

Expression Region

583-1063

Origin

Rubella virus (strain RA27/3 vaccine) (RUBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNHTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRTLAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDLGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR45L, NT (WDR45L, WIPI3, WD repeat domain phosphoinositide-interacting protein 3, WD repeat-containing protein 45-like, WIPI49-like protein) (Biotin)
MBS6363293-01 0.2 mL

WDR45L, NT (WDR45L, WIPI3, WD repeat domain phosphoinositide-interacting protein 3, WD repeat-containing protein 45-like, WIPI49-like protein) (Biotin)

Sign In for Pricing
View Details
WDR45L, NT (WDR45L, WIPI3, WD repeat domain phosphoinositide-interacting protein 3, WD repeat-containing protein 45-like, WIPI49-like protein) (Biotin)
MBS6363293-02 5x 0.2 mL

WDR45L, NT (WDR45L, WIPI3, WD repeat domain phosphoinositide-interacting protein 3, WD repeat-containing protein 45-like, WIPI49-like protein) (Biotin)

Sign In for Pricing
View Details
HnRNP H Rabbit Polyclonal Antibody (PE)
orb488505 100 µL

HnRNP H Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ARAF (Biotin)
555352-01 50 µg

ARAF (Biotin)

Sign In for Pricing
View Details
ARAF (Biotin)
555352-02 100 µg

ARAF (Biotin)

Sign In for Pricing
View Details
MIRA Canine Distemper Virus Fluorescence Detection Kit
WLDR11105K48 48 Tests/Box

MIRA Canine Distemper Virus Fluorescence Detection Kit

Sign In for Pricing
View Details