Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Sterol regulatory element-binding protein 2 (SREBF2)

This Recombinant Cricetulus griseus Sterol regulatory element-binding protein 2 (SREBF2) spans the amino acid sequence from region 1-482.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q60429

Expression Region

1-482

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDESSELGGLETMDTLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSS GSSSSSNSSSSSGSNSRGNGGAATDPGVQRSFSQVPLPTFSPSTASPQALALQVKVSPTP PRATPVLQPRPQPQPQPQPSAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQ AQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVL VQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPLQTGALQVPTLVGSNGTILTTM PVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDA KMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIE DFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRI LL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX 1 (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker) discontinued
C7904-70D 100 µg

COX 1 (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker) discontinued

Sign In for Pricing
View Details
TPX2 Monoclonal Antibody
bsm-51631M 100 µL

TPX2 Monoclonal Antibody

Sign In for Pricing
View Details
Bovine RETN (Resistin) ELISA Kit
EBv27493 96 Tests

Bovine RETN (Resistin) ELISA Kit

Sign In for Pricing
View Details
DMSO Resistant Peel Heat Seal, solvent resistant heat sealing foil, 1 perforated roll with 100 sheets (125 x 78mm)
4TI-0587 1 Perforated Roll With 100 Sheets (125 x 78 mm)

DMSO Resistant Peel Heat Seal, solvent resistant heat sealing foil, 1 perforated roll with 100 sheets (125 x 78mm)

Sign In for Pricing
View Details
RING Finger Protein 111 (RNF111, E3 Ubiquitin-protein Ligase Arkadia, ARK) (MaxLight 550)
132630-ML550 100 µL

RING Finger Protein 111 (RNF111, E3 Ubiquitin-protein Ligase Arkadia, ARK) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) mao Polyclonal Antibody
MBS7198565 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) mao Polyclonal Antibody

Sign In for Pricing
View Details