Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Sterol regulatory element-binding protein 2 (SREBF2)

This Recombinant Cricetulus griseus Sterol regulatory element-binding protein 2 (SREBF2) spans the amino acid sequence from region 1-482.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q60429

Expression Region

1-482

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDESSELGGLETMDTLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSS GSSSSSNSSSSSGSNSRGNGGAATDPGVQRSFSQVPLPTFSPSTASPQALALQVKVSPTP PRATPVLQPRPQPQPQPQPSAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQ AQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVL VQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPLQTGALQVPTLVGSNGTILTTM PVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDA KMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIE DFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRI LL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spike Protein (C-His, SARS-CoV-2)
P528696 100 µg

Spike Protein (C-His, SARS-CoV-2)

Sign In for Pricing
View Details
RBMY1F Polyclonal Antibody, APC Conjugated
bs-12290R-APC 100 µL

RBMY1F Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Human C6orf47 shRNA Plasmid
abx961690-01 150 µg

Human C6orf47 shRNA Plasmid

Sign In for Pricing
View Details
Human C6orf47 shRNA Plasmid
abx961690-02 300 µg

Human C6orf47 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG H&L Secondary Antibody-Gold
TMAB-02022G-01 500 μL

Rabbit Anti-Chicken IgG H&L Secondary Antibody-Gold

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG H&L Secondary Antibody-Gold
TMAB-02022G-02 1 mL

Rabbit Anti-Chicken IgG H&L Secondary Antibody-Gold

Sign In for Pricing
View Details