Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Grapevine leafroll-associated virus 3 Protein P55 (ORF5)

This Recombinant Grapevine leafroll-associated virus 3 Protein P55 (ORF5) spans the amino acid sequence from region 1-483.

Product Specifications

Product Name Alternative

Protein P55

UniProt

O41517

Expression Region

1-483

Origin

Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKYIYVTGILNPNEARDEVFSVVNKGYIGPGGRSFSNRGSKYTVVWENSAARISGFTST SQSTIDAFAYFLLKGGLTTTLSNPINCENWVRSSKDLSAFFRTLIKGKIYASRSVDSNLP KKDRDDIMEASRRLSPSDAAFCRAVSVQVGKYVDVTQNLESTIVPLRVMEIKKRRGSAHV SLPKVVSAYVDFYTNLQELLSDEVTRARTDTVSAYATDSMAFLVKMLPLTAREQWLKDVL GYLLVRRRPANFSYDVRVAWVYDVIATLKLVIRLFFNKDTPGGIKDLKPCVPIESFDPFH ELSSYFSRLSYEMTTGKGGKICPEIAEKLVRRLMEENYKLRLTPVMALIIILVYYSIYGT NATRIKRRPDFLNVRIKGRVEKVSLRGVEDRAFRISEKRGINAQRVLCRYYSDLTCLARR HYGIRRNNWKTLSYVDGTLAYDTADCITSKVRNTINTADHASIIHYIKTNENQVTGTTLP HQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Top1mt Mouse siRNA Oligo Duplex (Locus ID 72960)
SR417920 1 Kit

Top1mt Mouse siRNA Oligo Duplex (Locus ID 72960)

Sign In for Pricing
View Details
QPCTL Rabbit Polyclonal Antibody (APC)
orb999441 100 µL

QPCTL Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Olfr1372 (BC055827) Mouse Tagged Lenti ORF Clone
MR205202L3 10 µg

Olfr1372 (BC055827) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CNTNAP3 Human shRNA Plasmid Kit (Locus ID 79937)
TR317494 1 Kit

CNTNAP3 Human shRNA Plasmid Kit (Locus ID 79937)

Sign In for Pricing
View Details
Rabbit anti-mouse Fibroblast growth factor 1 polyclonal Antibody
MBS1490862-01 0.05 mg

Rabbit anti-mouse Fibroblast growth factor 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-mouse Fibroblast growth factor 1 polyclonal Antibody
MBS1490862-02 0.1 mg

Rabbit anti-mouse Fibroblast growth factor 1 polyclonal Antibody

Sign In for Pricing
View Details