Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Candida glabrata Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-483.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

Q6FX96

Expression Region

1-483

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIFTPPGKSDKRDANEEKPTLLGSNSKDETDVEKFWVRPSLGLKLWGPLVPASDNKTGL WTLVAVQSMVGLLCFYRFKSLRIIDRNGALNSVGKSGIRPTSVLVNEPKLYNSAFTQQEA VSGKPLVKKDIADFPTLNRFSTTHGDMFVNTTNVNRNTPSLSAAPVVASPVLSSAGHQSE IMAKSEAKNNWKSFFKSDNWLIFKKVFYLLAGSIILSQSMLEACRLTILRYDPWCEEAKT VREKKFFNNIVKFYHEGIDPTKVKVKDAVSGNIMPTNVPEVRQSVALVRAQTEAENPIIS WFGPIEYKPMTFSEFLDRLEYHLDMFEYFQGKRAANETALGFLTGIKTETSNLRDQNAQN RSRILKELKSEDQLSNDLSIKTGNAKIPKGTQRHGFSAAANRSIILEEDVAVPEDIDLNE IWTLYDPWLNLALETSLSIKFIPTVLINQDGITENSMMDTEATIGDKAGVIPENSNKPEE PRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF488A conjugate, 0.1mg/mL
BNC881705-100 1x 100 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF640R conjugate, 0.1mg/mL
BNC400052-500 1x 500 µL

HCG-intact (HCGab/52), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details