Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23C11.17 (SPAC23C11.17)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C23C11.17 (SPAC23C11.17) spans the amino acid sequence from region 1-485.

Product Specifications

Product Name Alternative

Uncharacterized protein C23C11.17

UniProt

O13920

Expression Region

1-485

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPRTHIQFPSMLRNRLFKTPHQTGFQWRLGAPATGITIRNQPIRSYSGLRGNFLIDKR LSPVKFNKYSPSDIVFYNIGSSRLYSTETPTPSKVKEAPKQVAAEETKPTTVVKKPSIWQ RVKGGVLHFWDGTKLLGVEIKISSKLVYKMAVGYELTRRESRQLTRTLKDIGRLVPFSVF VVVPFAELLLPIAVKLFPNLLPSTFEDAKDKEAKKAQLRKTRNEVSNMLRSTLKSGKFTF SNETRESKEFRDFFQKVRTSGQSPSREELIEVCKYFKDDITLDNLSRAQLVAMCRYMNLN AFGTDPLLRYNIRHRMRQIRRDDRAIYIEGINSLSIPELFNACNSRGIRTQGLSPAKLKE ELSVWLDMRIKHGIPSVILMLSNAFSYGYNEGTYDSRWDALQDTLASIPDELYHETVVDM PTKQVSNKERLEILREQEELIEEEAEHVAEHPDLAKKQTEENKATSKPAVSAKSPESNIP KNERK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF568 conjugate, 0.1mg/mL
BNC681981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF488A conjugate, 0.1mg/mL
BNC881571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF568 conjugate, 0.1mg/mL
BNC682153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL
BNC471959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details