Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-like protein 13 (BCL2L13)

This Recombinant Human Bcl-2-like protein 13 (BCL2L13) spans the amino acid sequence from region 1-485.

Product Specifications

Product Name Alternative

Bcl-2-like protein 13, Bcl2-L-13, Bcl-rambo, Protein Mil1

UniProt

Q9BXK5

Expression Region

1-485

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL ALRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN) (NM_002444) Human Over-expression Lysate
LY419318 100 µg

Moesin (MSN) (NM_002444) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802S-01 20 Tests

Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802S-02 100 Tests

Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802S-03 2x 100 Tests

Elab Fluor® Red 780 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UR-01 25 µg

Elab Fluor® Violet 500 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UR-02 100 µg

Elab Fluor® Violet 500 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details