Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1)

This Recombinant Macaca fascicularis FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

FAD-dependent oxidoreductase domain-containing protein 1

UniProt

Q4R510

Expression Region

1-486

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRRVLPHGLGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGTPCDVLPDTSHLP PEHSDVVVVGGGVLGLSVAYWLKQLENRRGGMRVLVVERDHTYSQASTGLSVGGICQQFS LPENIQLSLFSASFLRNINEYLAVTNAPPLDLQFNPSGYLLLASEKDAAAMESNVKVQKQ EGAKVCLMSPDQLRNKFPWINTEGVALASYGMENEGWFDPWCLLHGLRQKLMSMGVFFCQ GEVTRFVTSSQRMMTTDDEMVTLKSIHEVHVKMDHSLEYQPVECAIVINAAGAWSAQIAA LAGIGKGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYL GGRSPAEEEEPDPANLEVDHDFFQEKVWPHLALRVPAFETLKVQTAWAGYYDYNTFDQNG VVGPHPLVVNMYFATGFSGHGLQQAPGVGRAVAEMILEGSFQTIDLSPFLFNRFYLGEKT QENNIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL
BNC040021-500 1x 500 µL

Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details