Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cardiolipin synthase (cls)

This Recombinant Cardiolipin synthase (cls) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q66AL9

Expression Region

1-486

Origin

Yersinia pseudotuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVATPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cadherin-16 Antibody (rCDH16/1071) [mFluor Violet 450 SE]
NBP3-08881MFV450 0.1 mL

Mouse Monoclonal Cadherin-16 Antibody (rCDH16/1071) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
ZWAVELZUUR96%150X12CARD-T1-P21 Pipe Markers for Acids & Bases
N006973 5 Card (5 Marker (s) x 1 Card)

ZWAVELZUUR96%150X12CARD-T1-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
TFF1 Protein (C-Strep, Human)
P508980 100 µg

TFF1 Protein (C-Strep, Human)

Sign In for Pricing
View Details
Recombinant human LILRB1/CD85j/ILT2 protein
ATGP3965-020 20 µg

Recombinant human LILRB1/CD85j/ILT2 protein

Sign In for Pricing
View Details
TTC15, CT (TRAPPC12, TTC15, Trafficking protein particle complex subunit 12, Tetratricopeptide repeat protein 15) (MaxLight 750)
MBS6359857-01 0.1 mL

TTC15, CT (TRAPPC12, TTC15, Trafficking protein particle complex subunit 12, Tetratricopeptide repeat protein 15) (MaxLight 750)

Sign In for Pricing
View Details
TTC15, CT (TRAPPC12, TTC15, Trafficking protein particle complex subunit 12, Tetratricopeptide repeat protein 15) (MaxLight 750)
MBS6359857-02 5x 0.1 mL

TTC15, CT (TRAPPC12, TTC15, Trafficking protein particle complex subunit 12, Tetratricopeptide repeat protein 15) (MaxLight 750)

Sign In for Pricing
View Details