Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cardiolipin synthase (cls)

This Recombinant Cardiolipin synthase (cls) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q83RM8

Expression Region

1-486

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAHEYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER1 Knockout A2780 Polyclonal Cells
ARG29140 1 Million

HOMER1 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4, E2-2, ITF2, MGC149723, MGC149724, PTHS, SEF2, SEF2-1, SEF2-1A, SEF2-1B, bHLHb19) (MaxLight 650)
MBS6230266-01 0.1 mL

TCF4 (Transcription Factor 4, E2-2, ITF2, MGC149723, MGC149724, PTHS, SEF2, SEF2-1, SEF2-1A, SEF2-1B, bHLHb19) (MaxLight 650)

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4, E2-2, ITF2, MGC149723, MGC149724, PTHS, SEF2, SEF2-1, SEF2-1A, SEF2-1B, bHLHb19) (MaxLight 650)
MBS6230266-02 5x 0.1 mL

TCF4 (Transcription Factor 4, E2-2, ITF2, MGC149723, MGC149724, PTHS, SEF2, SEF2-1, SEF2-1A, SEF2-1B, bHLHb19) (MaxLight 650)

Sign In for Pricing
View Details
PRAS40 (AKT1S1) (NM_001098633) Human Tagged Lenti ORF Clone
RC212216L4 10 µg

PRAS40 (AKT1S1) (NM_001098633) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nek10 shRNA (h) Lentiviral Particles
sc-78343-V 200 µL

Nek10 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rat Heparan Sulphate Proteoglycan CLIA Kit
MBS8426784-01 1 Kit

Rat Heparan Sulphate Proteoglycan CLIA Kit

Sign In for Pricing
View Details