Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cardiolipin synthase (cls)

This Recombinant Cardiolipin synthase (cls) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

P63799

Expression Region

1-486

Origin

Salmonella typhi

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRGUK (Leucine-Rich Repeats and Guanylate Kinase Domain Containing, FLJ32786) (Biotin)
MBS6174705-01 0.1 mL

LRGUK (Leucine-Rich Repeats and Guanylate Kinase Domain Containing, FLJ32786) (Biotin)

Sign In for Pricing
View Details
LRGUK (Leucine-Rich Repeats and Guanylate Kinase Domain Containing, FLJ32786) (Biotin)
MBS6174705-02 5x 0.1 mL

LRGUK (Leucine-Rich Repeats and Guanylate Kinase Domain Containing, FLJ32786) (Biotin)

Sign In for Pricing
View Details
Zp1 Rat Pre-designed siRNA Set A
HY-RS24939 1 Set

Zp1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit
MBS013266-01 48 Well

Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit

Sign In for Pricing
View Details
Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit
MBS013266-02 96 Well

Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit

Sign In for Pricing
View Details
Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit
MBS013266-03 5x 96 Well

Rat Cutaneous T-Cell Lymphocyte Associated Antigen ELISA Kit

Sign In for Pricing
View Details