Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Cardiolipin synthase (cls)

This Recombinant Enterobacter sp. Cardiolipin synthase (cls) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

A4WB84

Expression Region

1-486

Origin

Enterobacter sp. (strain 638)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFYTVVSWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARAMWPSTAKWLNDLKSCKHIFAEENSSVASSLFKLCERRQGIAGVKGNQ LQLLTTSEDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAASRRGIHCRLMLD SAGSVAFFRSPWAGMMRNAGIEVVEALKVNLLRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRFFKQDSGVGQWIDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDANIMPF EQESGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIMPRKNDSVLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGGDLAAVQDDYISRSRLLDASLWVKRPLWQRITERLFY FFSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM23 (NM_018107) Human Recombinant Protein
PH42214M5 20 µg

RBM23 (NM_018107) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit
MBS764413-01 48 Well

Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit

Sign In for Pricing
View Details
Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit
MBS764413-02 96 Well

Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit

Sign In for Pricing
View Details
Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit
MBS764413-03 5x 96 Well

Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit

Sign In for Pricing
View Details
Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit
MBS764413-04 10x 96 Well

Mouse Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit

Sign In for Pricing
View Details
FAM3A Rabbit Polyclonal Antibody
TA356822 100 µL

FAM3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details