Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Cardiolipin synthase (cls)

This Recombinant Pectobacterium carotovorum subsp. carotovorum Cardiolipin synthase (cls) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

C6DGY3

Expression Region

1-486

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFYTVISWLLVFGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLVGIVAYLSFGE LHLGKRRAERASKMWPSTAKWLRELKEYRRIFATENSEVASALFQLCERRQGVGGVKGNQ LQLMTTFDDTIKALLRDIELARSNIEMVFYIWQPGGLVEQVSSSLIAAARRGVHCRILLD SAGSVQFFRQHHPELMRTAGIEVVEALKVNLFRAFLRRMDLRQHRKIILIDNRIAYTGSM NMVDPRFFKQDAGVGQWIDLMARIEGPVATTLGIIYCCDWEMETGKRLLPPPPDVNVMPF EQESGHTIQVIASGPGYPEEMIHQALLTSVYSARKQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPHKNDSVLVGWASRAFFTELLAAGVKIYQFKDGLLHTKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDAGFGSDLACVQEDYIARSRLLNATQWQNRPYWQRIVERLFY FFSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF405S conjugate, 0.1mg/mL
BNC041959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF488A conjugate, 0.1mg/mL
BNC880835-500 1x 500 µL

Cytokeratin 18 (KRT18/835), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details