Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse FAD-dependent oxidoreductase domain-containing protein 1 (Foxred1)

This Recombinant Mouse FAD-dependent oxidoreductase domain-containing protein 1 (Foxred1) spans the amino acid sequence from region 1-487.

Product Specifications

Product Name Alternative

FAD-dependent oxidoreductase domain-containing protein 1

UniProt

Q3TQB2

Expression Region

1-487

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQF SVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR QEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFC QGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIA ELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQGPGLETPLVADISGVYFRREGLGSNY LGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEVQSAWAGYYDYNTFDQN GVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTRFYLGEK LQEYNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (NX2/294), CF568 conjugate, 0.1mg/mL
BNC680294-500 1x 500 µL

NKX2.2 (NX2/294), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF594 conjugate, 0.1mg/mL
BNC941773-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF647 conjugate, 0.1mg/mL
BNC471975-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF488A conjugate, 0.1mg/mL
BNC882038-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details