Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hantaan virus Envelope glycoprotein (GP)

This Recombinant Hantaan virus Envelope glycoprotein (GP) spans the amino acid sequence from region 649-1135.

Product Specifications

Product Name Alternative

Envelope glycoprotein, GP, M polyprotein, Cleaved into the following 2 chains:, 1. Glycoprotein G1, 2. Glycoprotein G2

UniProt

P16853

Expression Region

649-1135

Origin

Hantaan virus (strain Lee) (Lee virus) (Korean hemorrhagic fever virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIE EQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPS DCPGVGTGCTACGLYLDRLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRH VKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEF PGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGML RDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIK ACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFKCCHGEDCSQIGLHAAAPHLDKVNG ISEMENSKEYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSLVLLSILCP VRKHKKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cux2 Rabbit pAb, PE-Cy7 conjugated
orb3002008 100 µL

Cux2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)
KTE20088-01 48 Tests

ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)
KTE20088-02 96 Tests

ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)
KTE20088-03 5x 96 Well

ELISA kit for Canine NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
ZNF688 Antibody
25-394 100 µL

ZNF688 Antibody

Sign In for Pricing
View Details
Anti-PRO1 | Profilin-1 (clone mAbPRF1a 2-14D9)
AS16 3210 100 µg

Anti-PRO1 | Profilin-1 (clone mAbPRF1a 2-14D9)

Sign In for Pricing
View Details