Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prospect Hill virus Envelope glycoprotein (GP)

This Recombinant Prospect Hill virus Envelope glycoprotein (GP) spans the amino acid sequence from region 655-1142.

Product Specifications

Product Name Alternative

Envelope glycoprotein, GP, M polyprotein, Cleaved into the following 2 chains:, 1. Glycoprotein G1, 2. Glycoprotein G2

UniProt

P27315

Expression Region

655-1142

Origin

Prospect Hill virus (PHV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DTVEIKTGWTDTAHGAGVIPLKSDLELDFSLPSSATYIYRRDLQNPANEQERIPFHFQLQ RQVIHAEIQNLGHWMDGTFNLKTSFHCYGACEKYAYPWQTAKCFLEKDYEFETGWGCNPG DCPGVGTGCTACGVYLDKLRSVGKVFKVISLKFTRRVCIQLGSEQSCKTIDSNDCLMTTS VKVCMIGTVSKFQPGDTLLFLGPLEEGGIIFKQWCTTTCHFGDPGDIMSTPQGMQCPEHT GAFRKKCAFATMPTCEYDGNTLSGYQRMLATRDSFQSFNITEPHITSNSLEWVDPDSSLK DHINLVVNRDVSFQDLSENPCQVGVAVSSIDGAWGSGVGFNLVCSVSLTECASFLTSIKA CDAAMCYGATTANLVRGQNTVHILGKGGHSGSKFMCCHSTECSSTGLTAAAPHLDRVTGY NVIDNDKVFDDGSPECGVHCWFKKSGEWLMGILSGNWMVVAVLVVLLILSIFLFSLCCPR RVVHKKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio Cholerae minC Protein (aa 1-220) (strain M66-2)
VAng-Cr2765-1mgEcoli 1 mg (E. coli)

Recombinant Vibrio Cholerae minC Protein (aa 1-220) (strain M66-2)

Sign In for Pricing
View Details
CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (PE)
MBS6156976-01 0.1 mL

CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (PE)

Sign In for Pricing
View Details
CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (PE)
MBS6156976-02 5x 0.1 mL

CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (PE)

Sign In for Pricing
View Details
α N-catenin shRNA (m) Lentiviral Particles
sc-43508-V 200 µL

α N-catenin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PIK3C2G Antibody
orb676249-01 50 µg

PIK3C2G Antibody

Sign In for Pricing
View Details
PIK3C2G Antibody
orb676249-02 100 µg

PIK3C2G Antibody

Sign In for Pricing
View Details