Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Puumala virus Envelope glycoprotein (GP)

This Recombinant Puumala virus Envelope glycoprotein (GP) spans the amino acid sequence from region 659-1148.

Product Specifications

Product Name Alternative

Envelope glycoprotein, GP, M polyprotein, Cleaved into the following 2 chains:, 1. Glycoprotein G1, 2. Glycoprotein G2

UniProt

P41265

Expression Region

659-1148

Origin

Puumala virus (strain K27)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ETQNLNAGWTDTAHGSGIIPMKTDLELDFSLPSSASYTYRRQLQNPANEQEKIPFHLQLS KQVIHAEIQHLGHWMDATFNLKTAFHCYGSCEKYAYPWQTAGCFIEKDYEYETGWGCNPP DCPGVGTGCTACGVYLDKLKSVGKVFKIVSLRYTRKVCIQLGTEQTCKTVDSNDCLITTS VKVCLIGTISKFQPSDTLLFLGPLQQGGLIFKQWCTTTCQFGDPGDIMSTPTGMKCPELN GSFRKKCAFATTPVCQFDGNTISGYKRMIATKDSFQSFNVTEPHISTSALEWIDPDSSLR DHINVIVSRDLSFQDLSETPCQIDLATASIDGAWGSGVGFNLVCTVSLTECSAFLTSIKA CDAAMCYGSTTANLVRGQNTIHIVGKGGHSGSKFMCCHDTKCSSTGLVAAAPHLDRVTGY NQADSDKIFDDGAPECGMSCWFKKSGEWILGVLNGNWMVVAVLVVLLILSILLFTLCCPR RPSYRKEHKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Silencer of Death Domain (BAG4) (NM_004874) AAV Particle
RC206235A1V 250 µL

Human Silencer of Death Domain (BAG4) (NM_004874) AAV Particle

Sign In for Pricing
View Details
Epha4 3'UTR Luciferase Stable Cell Line
TU204029 1.0 mL

Epha4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Keratin, type I cytoskeletal 14
MBS961967-01 0.02 mg (E-Coli)

Recombinant Human Keratin, type I cytoskeletal 14

Sign In for Pricing
View Details
Recombinant Human Keratin, type I cytoskeletal 14
MBS961967-02 0.1 mg (E-Coli)

Recombinant Human Keratin, type I cytoskeletal 14

Sign In for Pricing
View Details
Recombinant Human Keratin, type I cytoskeletal 14
MBS961967-03 1 mg (E-Coli)

Recombinant Human Keratin, type I cytoskeletal 14

Sign In for Pricing
View Details
Recombinant Human Keratin, type I cytoskeletal 14
MBS961967-04 5x 1 mg (E-Coli)

Recombinant Human Keratin, type I cytoskeletal 14

Sign In for Pricing
View Details