Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319) spans the amino acid sequence from region 1-491.

Product Specifications

Product Name Alternative

Probable CtpA-like serine protease, EC= 3.4.21.-

UniProt

Q49XN1

Expression Region

1-491

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESKDTTEVNQEVNEKASSQSTKKQINFKRSHFIIILIVTILVTAMIAVFATIGISHWT SGLNSDQRDEMKKVEQVYQTLDDEYYKDTSSEELGTAAIDGMVKKLDDPYSDYMTKKETK SFNEDVSGDFVGIGAEMQKKGNQIQITSPMKQSPAEKAGIQPKDVVTKVNGKSIKGQPLE AIVKKVRGKQGTKVTLTIERGGQAHDITIKRDKIHVKSVEYQKHGDVGVFTINKFQNSTS GELKSAIIKAHKDGIRKIVLDLRNNPGGLLDEAVKMANIFIDKNETVVQLEKGKHKEAIK ASNDASKEAKDMDVSILVNKGSASASEVFTGAMKDYNKAKVYGSKTFGKGIVQTTREFED GSLLKFTNMKWLTPKSHYIHGKGITPDKKIEEPAYQSLNVIPSNKTYQLGDDDKNVKTMK VGLNVLGYHINNHSTEFDSELEDALKSFQKKNNLDVNGTFNKSTNEKFTQQLVEKANKED TVLNELLKKLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF594 conjugate, 0.1mg/mL
BNC941099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF405S conjugate, 0.1mg/mL
BNC040205-500 1x 500 µL

Complement C4d (C4D205), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF405S conjugate, 0.1mg/mL
BNC040765-500 1x 500 µL

Chromogranin A (CHGA/765), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details