Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Protein TIC 55, chloroplastic (TIC55)

This Recombinant Arabidopsis thaliana Protein TIC 55, chloroplastic (TIC55) spans the amino acid sequence from region 49-539.

Product Specifications

Product Name Alternative

Protein TIC 55, chloroplastic, Translocon at the inner envelope membrane of chloroplasts 55, AtTIC55, Translocon at the inner envelope membrane of chloroplasts 55-II

UniProt

Q9SK50

Expression Region

49-539

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RSAVAGTAVSDQTEGGGDVLLNPEEEKRVEVADYDWTEEWYPLYLTKNVPEDAPLGLTVY DRQIVLYKDGEGTLRCYEDRCPHRLAKLSEGQLIDGRLECLYHGWQFEGEGKCVKIPQLP ASAKIPKAACVKTYEVKDSQGVVWVWMSTKTPPNPEKLPWFENFARPGFFDISTTHELPY DHSILLENLMDPAHVPISHDRTDFTAKREDAQPLVFEVTERSNRGFAGTWGREKEGGKGS NLLRFDAPCVLQNNREFEGKDGVKNYFSGLFLCRPTGQGKSMLIVRFGVTKRSPLVSVLP QWFWHQNACKVFEQDMGFLSSQNEVLMKEKVPTKDLYLNLKSSDTWVAEYRKWMDKVGHG MPYHFGHRTISLPKVPPVVEHAPAGLIAALSASYPAKGGIGTMHAPNLANRYFRHIIHCR SCSNVIKSFELWKNILSATAVALTALAILVVSRQWKAVLLGSAALCSAAAYTCLRAINLN TNNFIRTHRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL
BNC680810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF594 conjugate, 0.1mg/mL
BNC941897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL
BNC042957-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL
BNC470396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details