Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Major envelope glycoprotein (GP67)

This Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Major envelope glycoprotein (GP67) spans the amino acid sequence from region 18-509.

Product Specifications

Product Name Alternative

Major envelope glycoprotein, gp67

UniProt

P41717

Expression Region

18-509

Origin

Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEHCNAQMNSGPWRIKNLSIAPPKETLQKDVEIEIVETNMDENVIIGYKGYYQAYAYNGG SLDPNTRIEETMETLNVAKEDLLMWSIRRQCEVGEELIDQWGSDSDNCFRNKDGRGVWVF GKELVKRQNNNHFARHTCNRSWRCGVSTAKMYTRLECDNDNDECKVTILDINGASINVTE NTVLHRDGVSMVLKQKSTFSRRPEKVACLLIKDDKSDPRSVTREHCLVDNDIFDLSKNTW LCKFNRCIKRKSENVVKQRPPTWRHDVSAKHDEGASATKGDLMHIQEELMYENDLLRMNL ELMHAHINKLNNMLHNLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTHPPPHTS NCYNNSIYKEGRWVANTDSSQCIDFNNYKELAIDDDIEFWIPTIGNTTYHENWKDASGWS FIAQQKSNLISTMENTKFGGHTTSLSDITDMAKGELNAKLWSFMLGHAFSFMLTVGVIIF LFCMVRNRSRAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details