Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Cardiolipin synthase (cls)

This Recombinant Staphylococcus aureus Cardiolipin synthase (cls) spans the amino acid sequence from region 1-494.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

P63801

Expression Region

1-494

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMERRSANSIWAWLLVLVFLPLFGF ILYLLLGRQIQRDQIFKIDKEDKKGLELIVDEQLAALKNENFSNSNYQIVKFKEMIQMLL YNNAAFLTTDNDLKIYTDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKK AEQGVEVKILYDDMGSRGLRKKGLRPFRNKGGHAEAFFPSKLPLINLRMNNRNHRKIVVI DGQIGYVGGFNVGDEYLGKSKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQATRDHISY DDRYFPDVNSGGTIGVQIASSGPDEEWEQIKYGYLKMISSAKKSIYIQSPYFIPDQAFLD SIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLDAGVKVFHYDNGFLHSKTLVIDD EIASVGTANMDHRSFTLNFEVNAFIYDQQIAKKLKQAFIDDLAVSSELTKARYAKRSLWI KFKEGISQLLSPIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (FITC)
MBS6148500-01 0.1 mL

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (FITC)

Sign In for Pricing
View Details
NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (FITC)
MBS6148500-02 5x 0.1 mL

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (FITC)

Sign In for Pricing
View Details
Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit
MBS7216946-01 48 Well

Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit
MBS7216946-02 96 Well

Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit
MBS7216946-03 5x 96 Well

Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit
MBS7216946-04 10x 96 Well

Guinea pig Zinc finger protein neuro-d4 (DPF1) ELISA Kit

Sign In for Pricing
View Details