Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Langat virus Genome polyprotein

This Recombinant Langat virus Genome polyprotein spans the amino acid sequence from region 281-776.

Product Specifications

Product Name Alternative

Genome polyprotein, Cleaved into the following 5 chains:, 1. Capsid protein C, Core protein, prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E

UniProt

P29838

Expression Region

281-776

Origin

Langat virus (strain Yelantsev)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SRCTHLENRDFVTGVQGTTRLTLVLELGGCVTVTADGKPSLDVWLDSIYQESPAQTREYC LHAKLTGTKVAARCPTMGPATLPEEHQSGTVCKRDQSDRGWGNHCGLFGKGSIVTCVKFT CEDKKKATGHVYDVNKITYTIKVEPHTGEFVAANETHSGRKSASFTVSSEKTILTLGDYG DVSLLCRVASGVDLAQTVVLALDKTHEHLPTAWQVHRDWFNDLALPWKHDGAEAWNEAGR LVEFGTPHAVKMDVFNLGDQTGVLLKSLAGVPVASIEGTKYHLKSGHVTCEVGLEKLKMK GLTYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITP NPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQKGSSIGRVLQKTRKGIERLTVLGEHA WDFGSVGGVMTSIGRAMHTVLGGAFNTLLGGVGFLPKILLGVAMAWLGLNMRNPTLSMGF LLSGGLVLAMTLGVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit
MBS7218352-01 48 Well

Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit

Sign In for Pricing
View Details
Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit
MBS7218352-02 96 Well

Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit

Sign In for Pricing
View Details
Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit
MBS7218352-03 5x 96 Well

Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit

Sign In for Pricing
View Details
Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit
MBS7218352-04 10x 96 Well

Mouse Cell cycle control protein 50C (TMEM30C) ELISA Kit

Sign In for Pricing
View Details
ELN Polyclonal Antibody
E-AB-14058-01 20 µL

ELN Polyclonal Antibody

Sign In for Pricing
View Details
ELN Polyclonal Antibody
E-AB-14058-02 60 µL

ELN Polyclonal Antibody

Sign In for Pricing
View Details