Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable CtpA-like serine protease (MW1310)

This Recombinant Staphylococcus aureus Probable CtpA-like serine protease (MW1310) spans the amino acid sequence from region 1-496.

Product Specifications

Product Name Alternative

Probable CtpA-like serine protease, EC= 3.4.21.-

UniProt

Q8NWR2

Expression Region

1-496

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNETTQFDQALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL
BNC470531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL
BNC942152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF405S conjugate, 0.1mg/mL
BNC040950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details