Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 18-516.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

P0CN67

Expression Region

18-516

Origin

Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RPLSTTAPSFIRIRSQASEPSPAERPPPVPENVNPSQPFEPEVSKSEGTAKAAETQQAEE PASAGTPLTPPQPEVVFGNTHSAASTTPETEPNVENPDYSKLPSLDIDQEAAAISEPATG KDQEVEGGERKKTGAGKKEYVSSQEKSRRMWIRAGYGALAVGAVGAVLAMGNDETTGKKQ GGFVETFQNNMLELFDFFNKPAFQTLLPDPLPPPHQRPYTLCIDLEGLLVHSSWDRTHGW RTAKRPGVDYFLGYLSQFYEIVLFSSQPLYTAAPIAEKIDPYQAFMPYRLFRESTRSVKG KVVKDISFLNRDPSKVIVLDVNPEHVALQPENGIVLQPWNGSPGDKGLVDMIPFLESIGI FNPADVRPILQAYAGKDIPIEYAKKEAEAKAKAIEEWERAHPTAITGAGSGFLSSIFGSV AAPGSSRPNQPMTYLEQKRAQAQRIYQEEQKYWAEHADEFKKLIEEDKQRQLAEMKGSIL GYLGAPKMQDGPKEEVLKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (MaxLight 490)
MBS6200504-01 0.1 mL

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (MaxLight 490)

Sign In for Pricing
View Details
DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (MaxLight 490)
MBS6200504-02 5x 0.1 mL

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (MaxLight 490)

Sign In for Pricing
View Details
4-Nitrobenzyl cyanide
FN70469-01 0.25 kg

4-Nitrobenzyl cyanide

Sign In for Pricing
View Details
4-Nitrobenzyl cyanide
FN70469-02 0.5 Kg

4-Nitrobenzyl cyanide

Sign In for Pricing
View Details
PE-Cy5.5 Anti-Human/Mouse/Rat CD47 Antibody (MIAP410)
PC55-30031U-01 25 µg

PE-Cy5.5 Anti-Human/Mouse/Rat CD47 Antibody (MIAP410)

Sign In for Pricing
View Details
PE-Cy5.5 Anti-Human/Mouse/Rat CD47 Antibody (MIAP410)
PC55-30031U-02 100 µg

PE-Cy5.5 Anti-Human/Mouse/Rat CD47 Antibody (MIAP410)

Sign In for Pricing
View Details