Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant LEM protein 2 (lem-2)

This Recombinant LEM protein 2 (lem-2) spans the amino acid sequence from region 1-500.

Product Specifications

Product Name Alternative

LEM protein 2, Ce-MAN1, MAN1 homolog

UniProt

Q9XTB5

Expression Region

1-500

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDVEKMSDAELRAELNVRGANVGPVTGTTRSLYEKKLKKLLSGGAKTPARPTVAKPAPK PTPKSAPAPKSPKSPPARRSIPRAAATAANSTINSTFNRSEIEEMSDSDDDMRDDDDDDE EILSPKSKQSSFRSANSTASSVGRGRPVSSTPNKRLSPVYKPSPVPKNTPRTTSSSSKTT INTTTTRIPSTPRRITSVPGLITDFTPSFSTFGSDRPGATPPRKSIYTSKVSKVLHDLGN TTGEEDDDDEFEGQETSRIIYKTEEPSRRGIVKNAWNKVLGYGFDASKNPGDSYDLRAGA SRIRVQKNPRTGKVTVKQTNIFNEAIYFALYVILILFVVLGIAYALTTTHRPKTADFSGY WGVLKAAGRDSLNFFYNYAILPVVSLGIFVVLGAGIYFGHRKYKEAKEQEEAKLYELIER ITELIRESSIDGDPYVSQPHVRDVLFPPAKRRSAELARWEQAVKFIDTNESRVATDVLVL PSGNECAVWKWIGNQSQKRW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TDO2 Antibody
H00006999-D01P 0.1 mg

Rabbit Polyclonal TDO2 Antibody

Sign In for Pricing
View Details
Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit
MBS9919551-01 48 Well

Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit
MBS9919551-02 96 Well

Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit
MBS9919551-03 5x 96 Well

Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit

Sign In for Pricing
View Details
Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit
MBS9919551-04 10x 96 Well

Sheep Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit

Sign In for Pricing
View Details
Human ACSS1 (NM_001252677) AAV Particle
RC234470A1V 250 µL

Human ACSS1 (NM_001252677) AAV Particle

Sign In for Pricing
View Details