Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dhori virus Envelope glycoprotein (P4)

This Recombinant Dhori virus Envelope glycoprotein (P4) spans the amino acid sequence from region 21-521.

Product Specifications

Product Name Alternative

Envelope glycoprotein

UniProt

P27427

Expression Region

21-521

Origin

Dhori virus (strain Indian/1313/61) (Dho)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IEVCNKAQQQGPYTLVDYQEKPLNISRIQIKVVKTSVATKGLNFHIGYRAVWRGYCYNGG SLDKNTGCYNDLIPKSPTESELRTWSKSQKCCTGPDAVDAWGSDARICWAEWKMELCHTA KELKKYSNNNHFAYHTCNLSWRCGLKSTHIEVRLQASGGLVSMVAVMPNGTLIPIEGTRP TYWTEDSFAYLYDPAGTEKKTESTFLWCFKEHIRPTTELSGAVYDTHYLGGTYDKNPQFN YYCRDNGYYFELPANRLVCLPTSCYKREGAIVNTMHPNTWKVSEKLHSASQFDVNNVVHS LVYETEGLRLALSQLDHRFATLSRLFNRLTQSLAKIDDRLLGTLLGQDVSSKFISPTKFM LSPCLSTPEGDSNCHNHSIYRDGRWVHNSDPTQCFSLSKSQPVDLYSFKELWLPQLLDVN VKGVVADEEGWSFVAQSKQALIDTMTYTKNGGKGTSLEDVLGYPSGWINGKLQGLLLNGA ISWVVVIGVVLVGVCLMRRVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9630009A06Rik Mouse siRNA Oligo Duplex (Locus ID 78568)
SR400488 1 Kit

9630009A06Rik Mouse siRNA Oligo Duplex (Locus ID 78568)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)
MBS1128464-01 0.02 mg (E-Coli)

Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)
MBS1128464-02 0.1 mg (E-Coli)

Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)
MBS1128464-03 0.02 mg (Yeast)

Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)
MBS1128464-04 0.1 mg (Yeast)

Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)
MBS1128464-05 0.02 mg (Baculovirus)

Recombinant Kineococcus radiotolerans Cell division protein SepF (sepF)

Sign In for Pricing
View Details