Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orientia tsutsugamushi 56 kDa type-specific antigen

This Recombinant Orientia tsutsugamushi 56 kDa type-specific antigen spans the amino acid sequence from region 23-524.

Product Specifications

Product Name Alternative

56 kDa type-specific antigen, TSA, 56 kDa scrub typhus antigen, STA56, TSG56

UniProt

P22940

Expression Region

23-524

Origin

Orientia tsutsugamushi (Rickettsia tsutsugamushi)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IELGEEGGLECGPYGKVGIVGGMITGAESTRLDSTDSEGKKHLSLTTGLPFGGTLAAGMT IAPGFRAELGVMYLRNISAEVEVGKGKVDSKGEIKADSGGGTDTPIRKRFKLTPPQPTIM PISIADRDVGVDTDILAQAAAGQPQLTVEQRAADRIAWLKNYAGIDYMVPDPQNPNARVI NPVLLNITQGPPNVQPRPRQNLDILDHGQWRHLVVGVTALSHANKPSVTPVKVLSDKITK IYSDIKPFADIAGIDVPDTGLPNSASVEQIQSKMQELNDVLEDLRDSFDGYMGNAFANQI QLNFVMPQQAQQQQGQGQQQQAQATAQEAVAAAAVRLLNGNDQIAQLYKDLVKLQRHAGV KKAMEKLAAQQEEDAKNQGEGDCKQQQGASEKSKEGKGKETEFDLSMIVGQVKLYADLFT TESFSIYAGVGAGLAHTYGKIDDKDIKGHTGMVASGALGVAINAAEGVYVDLEGSYMHSF SKIEEKYSINPLMASVGVRYNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor/RNH1 Rabbit Polyclonal Antibody (PE)
orb2618461 100 µg

Ribonuclease Inhibitor/RNH1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Leptin (LEP) Magnetic Fluorescence Assay Kit
MBS2154703-01 96 Tests

Leptin (LEP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Leptin (LEP) Magnetic Fluorescence Assay Kit
MBS2154703-02 5x 96 Tests

Leptin (LEP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Leptin (LEP) Magnetic Fluorescence Assay Kit
MBS2154703-03 10x 96 Tests

Leptin (LEP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, CANDF4, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (AP) discontinued
D1876-48R-AP 100 µL

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, CANDF4, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral human ASB7 shRNA (UAS) - Lentiviral human ASB7 shRNA (UAS, RFP) plasmid
GTR15149809 1 Vial

Lentiviral human ASB7 shRNA (UAS) - Lentiviral human ASB7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details