Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase D4 (Pld4)

This Recombinant Mouse Phospholipase D4 (Pld4) spans the amino acid sequence from region 1-503.

Product Specifications

Product Name Alternative

Phospholipase D4, PLD 4, EC= 3.1.4.4, Choline phosphatase 4, Phosphatidylcholine-hydrolyzing phospholipase D4

UniProt

Q8BG07

Expression Region

1-503

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKKKEHPEMRIPLQTAVEVSDWPCSTSHDPHSGLGMVLGMLAVLGLSSVTLILFLWQGA TSFTSHRMFPEEVPSWSWETLKGDAEQQNNSCQLILVESIPEDLPFAAGSPTAQPLAQAW LQLLDTARESVHIASYYWSLTGLDIGVNDSSSRQGEALLQKFQQLLLRNISVVVATHSPT LAKTSTDLQVLAAHGAQIRQVPMKQLTGGVLHSKFWVVDGRHIYVGSANMDWRSLTQVKE LGAIIYNCSNLAQDLEKTFQTYWVLGTPQAVLPKTWPRNFSSHINRFHPLRGPFDGVPTT AYFSASPPSLCPHGRTRDLDAVLGVMEGARQFIYVSVMEYFPTTRFTHHARYWPVLDNAL RAAALNKGVHVRLLVSCWFNTDPTMFAYLRSLQAFSNPSAGISVDVKVFIVPVGNHSNIP FSRVNHSKFMVTDKTAYVGTSNWSEDYFSHTAGVGLIVSQKTPRAQPGATTVQEQLRQLF ERDWSSHYAMDLDRQVPSQDCVW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 Polyclonal Antibody, Cy7 Conjugated
bs-6028R-Cy7 100 µL

CD16 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)
134274-ML490 100 µL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit
MBS9944281-01 48 Well

Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit
MBS9944281-02 96 Well

Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit
MBS9944281-03 5x 96 Well

Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit
MBS9944281-04 10x 96 Well

Mouse Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3B (GSPT2) ELISA Kit

Sign In for Pricing
View Details