Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Protochlorophyllide-dependent translocon component 52, chloroplastic (PTC52)

This Recombinant Arabidopsis thaliana Protochlorophyllide-dependent translocon component 52, chloroplastic (PTC52) spans the amino acid sequence from region 56-559.

Product Specifications

Product Name Alternative

Protochlorophyllide-dependent translocon component 52, chloroplastic, ACD1-like protein, Protein TIC 55-IV, Translocon at the inner envelope membrane of chloroplasts 55-IV

UniProt

Q8W496

Expression Region

56-559

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSAATSTNSPPEPEALFEPGSDKFDWYANWYPVMPICDLDKKVPHGKKVMGIDLVVWWDR NEKQWKVMDDTCPHRLAPLSDGRIDQWGRLQCVYHGWCFNGSGDCKLIPQAPPDGPPVHT FKQACVAVYPSTVQHEIIWFWPNSDPKYKNIIETNKPPYIPELEDPSFTKLMGNRDIPYG YDVLVENLMDPAHVPYAHYGLMRFPKPKGKYIICISNSCFNPFTNLQILLAEKIDREGGK PLEINVKKLDNKGFFSKQEWGYSNFIAPCVYRSSTDPLPEQEHEYPAPAASDKAALSKRR LSLIFICIPVSPGRSRLIWTFPRNFGVFIDKIVPRWVFHIGQNTILDSDLHLLHVEERKI LERGPENWQKACFIPTKSDANVVTFRRWFNKYSEARVDWRGKFDPFLLPPTPPREQLFDR YWSHVENCSSCKKAHKYLNALEVILQIASVAMIGVMAVLKQTTMSNVARIAVLVAAVLSF AASKWLSHFIYKTFHYHDYNHAVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL
BNC941953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117), CF640R conjugate, 0.1mg/mL
BNC400476-100 1x 100 µL

CD79a (JCB117), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details