Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabies virus Glycoprotein G (G)

This Recombinant Rabies virus Glycoprotein G (G) spans the amino acid sequence from region 20-524.

Product Specifications

Product Name Alternative

Glycoprotein G

UniProt

P08667

Expression Region

20-524

Origin

Rabies virus (strain Pasteur vaccins / PV) (RABV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKMNGFT CTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYH WLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPGGNCSGVAVSSTYCSTNHDYTIWMP ENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTW VAMQTSNETKWCPPGQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRR LSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFF NGIILGPDGNVLIPEMQSSLLQQHMELLVSSVIPLMHPLADPSTVFKNGDEAEDFVEVHL PDVHERISGVDLGLPNWGKYVLLSAGALTALMLIIFLMTCWRRVNRSEPTQHNLRGTGRE VSVTPQSGKIISSWESYKSGGETGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine CARTPT protein, C-Fc Tag
MBS157011-01 0.05 mg

Recombinant Bovine CARTPT protein, C-Fc Tag

Sign In for Pricing
View Details
Recombinant Bovine CARTPT protein, C-Fc Tag
MBS157011-02 0.1 mg

Recombinant Bovine CARTPT protein, C-Fc Tag

Sign In for Pricing
View Details
Recombinant Bovine CARTPT protein, C-Fc Tag
MBS157011-03 5x 0.1 mg

Recombinant Bovine CARTPT protein, C-Fc Tag

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit
CSB-EL003650MO-01 24 Well

Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit
CSB-EL003650MO-02 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit
CSB-EL003650MO-03 5x 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5) ELISA kit

Sign In for Pricing
View Details