Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant His1 virus Putative transmembrane protein ORF27 (ORF27)

This Recombinant His1 virus Putative transmembrane protein ORF27 (ORF27) spans the amino acid sequence from region 1-505.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF27

UniProt

Q25BG8

Expression Region

1-505

Origin

His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEKTTKSKNSIATKNIVRVSLICFLLVFSVTVPFVFSPVSNASGQTTTLVDGFEDGTLS PWQTFQSFSVNTNNPYKGDYSAVANSDDNTIFVTTNNDQYTAATVAVNIKDSNNNARILF QDRPDSNNADLLANIYIESGNVGFYGGNGQDTGIDISYSEWVVFEIKNIDYSNQKYDIEV YDKSGNSLGSFSGADFYDSVSSMNGVDIYKVDSGSRVDHFTTGEFVSKSTVSGNVTDLEG NPMANATVTADSVSTTTDDNGSYSIKLADGTYDITANKKNYKPQTKQIEVNGSAKTVDFS LGKIEKQLSIEGPNFVRPNQTIPYKVEYTNETGTYDVSNYSNITSANTTLLSIDETNKTL LAGGQNATVKVTAKYNTTEVTTNVTKQYYVSYLKLENIDTVPPAKWMQAFLGFDDGYAEN KNMKGIGSDIQWLLFTVIIMSTIAKLFDNPWAGIGSGVITGVLLWVLEYIGLGLLLSMVF FGIFIGLILVRVRRDGGNEVTINES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-500 1x 500 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF405S conjugate, 0.1mg/mL
BNC041577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF405S conjugate, 0.1mg/mL
BNC041982-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details