Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-5 secretion system protein eccB5 (eccB5)

This Recombinant ESX-5 secretion system protein eccB5 (eccB5) spans the amino acid sequence from region 1-506.

Product Specifications

Product Name Alternative

ESX-5 secretion system protein eccB5, ESX conserved component B5, Type VII secretion system protein eccB5, T7SS protein eccB5

UniProt

O53933

Expression Region

1-506

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEESRGQRGSGYGLGLSTRTQVTGYQFLARRTAMALTRWRVRMEIEPGRRQTLAVVASV SAALVICLGALLWSFISPSGQLNESPIIADRDSGALYVRVGDRLYPALNLASARLITGRP DNPHLVRSSQIATMPRGPLVGIPGAPSSFSPKSPPASSWLVCDTVATSSSIGSLQGVTVT VIDGTPDLTGHRQILSGSDAVVLRYGGDAWVIREGRRSRIEPTNRAVLLPLGLTPEQVSQ ARPMSRALFDALPVGPELLVPEVPNAGGPATFPGAPGPIGTVIVTPQISGPQQYSLVLGD GVQTLPPLVAQILQNAGSAGNTKPLTVEPSTLAKMPVVNRLDLSAYPDNPLEVVDIREHP STCWWWERTAGENRARVRVVSGPTIPVAATEMNKVVSLVKADTSGRQADQVYFGPDHANF VAVTGNNPGAQTSESLWWVTDAGARFGVEDSKEARDALGLTLTPSLAPWVALRLLPQGPT LSRADALVEHDTLPMDMTPAELVVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABflo® 594 Rabbit anti-Human CD55 mAb
A24792-01 50 Tests

ABflo® 594 Rabbit anti-Human CD55 mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Human CD55 mAb
A24792-02 100 Tests

ABflo® 594 Rabbit anti-Human CD55 mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Human CD55 mAb
A24792-03 200 Tests

ABflo® 594 Rabbit anti-Human CD55 mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Human CD55 mAb
A24792-04 500 Tests

ABflo® 594 Rabbit anti-Human CD55 mAb

Sign In for Pricing
View Details
Recombinant Haemophilus phage HP1 Uncharacterized 8.9 kDa protein in int-C1 intergenic region
MBS1140853-01 0.02 mg (E-Coli)

Recombinant Haemophilus phage HP1 Uncharacterized 8.9 kDa protein in int-C1 intergenic region

Sign In for Pricing
View Details
Recombinant Haemophilus phage HP1 Uncharacterized 8.9 kDa protein in int-C1 intergenic region
MBS1140853-02 0.1 mg (E-Coli)

Recombinant Haemophilus phage HP1 Uncharacterized 8.9 kDa protein in int-C1 intergenic region

Sign In for Pricing
View Details